Browse Source

add jupyter files

master
wjtest001 2 years ago
parent
commit
41281478c7
8 changed files with 814 additions and 0 deletions
  1. +1
    -0
      001.ipynb
  2. +23
    -0
      1.ipynb
  3. +251
    -0
      1Untitled.ipynb
  4. +1
    -0
      notebooks/1.md
  5. +35
    -0
      notebooks/testwj.ipynb
  6. +1
    -0
      notebooks/test测试/1.txt
  7. +251
    -0
      notebooks/test测试/wj-Untitled.ipynb
  8. +251
    -0
      notebooks/wj-Untitled.ipynb

+ 1
- 0
001.ipynb View File

@@ -0,0 +1 @@
hello world

+ 23
- 0
1.ipynb View File

@@ -0,0 +1,23 @@
# Wild type sequence provided in the "Dataset Description":
wtseq <- 'VPVNPEPDATSVENVALKTGSGDSQSDPIKADLEVKGQSALPFDVDCWAILCKGAPNVLQRVNEKTKNSNRDRSGANKGPFKDPQKWGIKALPPKNPSWSAQDFKSPEEYAFASSLQGGTNAILAPVNLASQNSQGGVLNGFYSANKVAQFDPSKPQQTKGTWFQITKFTGAAGPYCKALGSNDKSVCDKNKNIAGDWGFDPAKWAYQYDEKNNKFNYVGK'

# Read testing set sequences and pH:
test <- read.csv('../input/novozymes-enzyme-stability-prediction/test.csv')

# Add mutation information to testing set:
test[,c('type','resid','wt','mut')] <- do.call(rbind,lapply(test$protein_sequence,function(seq){
# case 1 = wild type:
if(seq==wtseq){
return(c('WT',-1,'_','_'))
# case 2 = substitution:
} else if(nchar(seq)==nchar(wtseq)){
i <- mapply(function(x,y) which(x!=y)[1], strsplit(seq,""), strsplit(wtseq,""))
return(c('SUB',i,substr(wtseq,i,i),substr(seq,i,i)))
# case 3 = deletion:
} else if(nchar(seq)<nchar(wtseq)){
wtsub <- substr(wtseq,1,nchar(seq))
i <- mapply(function(x,y) which(x!=y)[1], strsplit(seq,""), strsplit(wtsub,""))
return(c('DEL',i,substr(wtseq,i,i),'_'))
}
}))
head(test)

+ 251
- 0
1Untitled.ipynb View File

@@ -0,0 +1,251 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": 1,
"id": "90e7b1d4",
"metadata": {},
"outputs": [
{
"ename": "ModuleNotFoundError",
"evalue": "No module named 'torch'",
"output_type": "error",
"traceback": [
"\u001b[0;31m---------------------------------------------------------------------------\u001b[0m",
"\u001b[0;31mModuleNotFoundError\u001b[0m Traceback (most recent call last)",
"\u001b[0;32m<ipython-input-1-e39e8fd52943>\u001b[0m in \u001b[0;36m<module>\u001b[0;34m\u001b[0m\n\u001b[1;32m 8\u001b[0m \u001b[0;32mimport\u001b[0m \u001b[0myaml\u001b[0m\u001b[0;34m\u001b[0m\u001b[0;34m\u001b[0m\u001b[0m\n\u001b[1;32m 9\u001b[0m \u001b[0;32mimport\u001b[0m \u001b[0mpickle\u001b[0m\u001b[0;34m\u001b[0m\u001b[0;34m\u001b[0m\u001b[0m\n\u001b[0;32m---> 10\u001b[0;31m \u001b[0;32mimport\u001b[0m \u001b[0mtorch\u001b[0m\u001b[0;34m\u001b[0m\u001b[0;34m\u001b[0m\u001b[0m\n\u001b[0m\u001b[1;32m 11\u001b[0m \u001b[0;32mimport\u001b[0m \u001b[0mtorch\u001b[0m\u001b[0;34m.\u001b[0m\u001b[0mnn\u001b[0m \u001b[0;32mas\u001b[0m \u001b[0mnn\u001b[0m\u001b[0;34m\u001b[0m\u001b[0;34m\u001b[0m\u001b[0m\n\u001b[1;32m 12\u001b[0m \u001b[0;32mimport\u001b[0m \u001b[0mnumpy\u001b[0m \u001b[0;32mas\u001b[0m \u001b[0mnp\u001b[0m\u001b[0;34m\u001b[0m\u001b[0;34m\u001b[0m\u001b[0m\n",
"\u001b[0;31mModuleNotFoundError\u001b[0m: No module named 'torch'"
]
}
],
"source": [
"# -*- coding: utf-8 -*-\n",
"from __future__ import print_function, division\n",
"\n",
"# import sys\n",
"# sys.path.append('/home/xujiahong/openI_benchmark/vechicle_reID_VechicleNet/')\n",
"\n",
"import time\n",
"import yaml\n",
"import pickle\n",
"import torch\n",
"import torch.nn as nn\n",
"import numpy as np\n",
"from torchvision import datasets,transforms\n",
"import os\n",
"import scipy.io\n",
"from tqdm import tqdm\n",
"from data_utils.model_train import ft_net\n",
"from utils.util import get_stream_logger\n",
"from config.mainconfig import OUTPUT_RESULT_DIR, CONFIG_PATH\n",
"\n",
"\n",
"\n",
"def fliplr(img):\n",
" '''flip horizontal'''\n",
" inv_idx = torch.arange(img.size(3)-1,-1,-1).long() # N x C x H x W\n",
" img_flip = img.index_select(3,inv_idx)\n",
" return img_flip\n",
"\n",
"def extract_feature(model, dataloaders, flip):\n",
" features = torch.FloatTensor()\n",
" count = 0\n",
" for _, data in enumerate(tqdm(dataloaders),0):\n",
" img, _ = data\n",
" n, c, h, w = img.size()\n",
" count += n\n",
"\n",
" input_img = img.cuda()\n",
" ff = model(input_img)\n",
"\n",
" if flip:\n",
" img = fliplr(img)\n",
" input_img = img.cuda()\n",
" outputs_flip = model(input_img)\n",
" ff += outputs_flip\n",
"\n",
" fnorm = torch.norm(ff, p=2, dim=1, keepdim=True)\n",
" ff = ff.div(fnorm.expand_as(ff))\n",
" #print(ff.shape)\n",
" features = torch.cat((features,ff.data.cpu().float()), 0)\n",
" #features = torch.cat((features,ff.data.float()), 0)\n",
" return features\n",
"\n",
"\n",
"def get_id(img_path):\n",
" '''\n",
" xjh: \n",
" example of the name of the img: 0769_c013_00074310_0\n",
" 0769 is the vehicleID, 013 is the cameraID, 00074310 is the frameID\n",
" '''\n",
" camera_id = []\n",
" labels = []\n",
" for path, _ in img_path:\n",
" #filename = path.split('/')[-1]\n",
" filename = os.path.basename(path) #get the name of images\n",
" # Test Gallery Image\n",
" if not 'c' in filename: \n",
" labels.append(9999999)\n",
" camera_id.append(9999999)\n",
" else:\n",
" #label = filename[0:4]\n",
" label = filename[0:5] #for benchmark_person\n",
" camera = filename.split('c')[1]\n",
" if label[0:2]=='-1':\n",
" labels.append(-1)\n",
" else:\n",
" labels.append(int(label))\n",
" #camera_id.append(int(camera[0:3]))\n",
" camera_id.append(int(camera[0:2]))#for benchmark_person\n",
" #print(camera[0:3])\n",
" return camera_id, labels\n",
"\n",
"\n",
"def test(config_file_path:str, logger):\n",
" #read config files\n",
" with open(config_file_path, encoding='utf-8') as f:\n",
" opts = yaml.load(f, Loader=yaml.SafeLoader)\n",
"\n",
" data_dir = opts['input']['dataset']['data_dir']\n",
" name = \"trained_\" + opts['input']['config']['name']\n",
" trained_model_name = name + \"_last.pth\"\n",
" save_path = OUTPUT_RESULT_DIR\n",
"\n",
" nclass = opts['input']['config']['nclass']\n",
" stride = opts['input']['config']['stride']\n",
" pool = opts['input']['config']['pool']\n",
" droprate = opts['input']['config']['droprate']\n",
" inputsize= opts['input']['config']['inputsize']\n",
" w = opts['input']['config']['w']\n",
" h = opts['input']['config']['h']\n",
" batchsize = opts['input']['config']['batchsize']\n",
" flip = opts['test']['flip_test']\n",
"\n",
" trained_model_path = os.path.join(save_path, trained_model_name)\n",
"\n",
" ##############################load model#################################################\n",
" ###self-train\n",
" model = ft_net(class_num = nclass, droprate = droprate, stride=stride, init_model=None, pool = pool, return_f=False)\n",
" \n",
" try:\n",
" model.load_state_dict(torch.load(trained_model_path))\n",
" except:\n",
" model = torch.nn.DataParallel(model)\n",
" model.load_state_dict(torch.load(trained_model_path))\n",
" model = model.module\n",
" model.classifier.classifier = nn.Sequential() #model ends with feature extractor(output len is 512)\n",
" # print(model)\n",
" \n",
" ##############################load dataset###############################################\n",
" \n",
" #transforms for input image h==w==299, inputsize==256\n",
" if h == w:\n",
" data_transforms = transforms.Compose([\n",
" transforms.Resize( ( round(inputsize*1.1), round(inputsize*1.1)), interpolation=3),\n",
" transforms.ToTensor(),\n",
" transforms.Normalize([0.485, 0.456, 0.406], [0.229, 0.224, 0.225])\n",
" ])\n",
" else:\n",
" data_transforms = transforms.Compose( [\n",
" transforms.Resize((round(h*1.1), round(w*1.1)), interpolation=3), #Image.BICUBIC\n",
" transforms.ToTensor(),\n",
" transforms.Normalize([0.485, 0.456, 0.406], [0.229, 0.224, 0.225])\n",
" ])\n",
"\n",
" image_datasets = {x: datasets.ImageFolder( os.path.join(data_dir,x) ,data_transforms) for x in ['bounding_box_test','query']}\n",
" dataloaders = {x: torch.utils.data.DataLoader(image_datasets[x], batch_size=batchsize,\n",
" shuffle=False, num_workers=8) for x in ['bounding_box_test','query']}\n",
"\n",
" #############################check GPU###################################################\n",
" use_gpu = torch.cuda.is_available()\n",
"\n",
"\n",
" #############################extract features############################################\n",
" # Change to test mode\n",
" model = model.eval()\n",
" if use_gpu:\n",
" model = model.cuda()\n",
"\n",
" gallery_path = image_datasets['bounding_box_test'].imgs\n",
" query_path = image_datasets['query'].imgs\n",
"\n",
" gallery_cam,gallery_label = get_id(gallery_path)\n",
" query_cam,query_label = get_id(query_path)\n",
"\n",
"\n",
" gallery_label = np.asarray(gallery_label)\n",
" query_label = np.asarray(query_label)\n",
" gallery_cam = np.asarray(gallery_cam)\n",
" query_cam = np.asarray(query_cam)\n",
" print('Gallery Size: %d'%len(gallery_label))\n",
" print('Query Size: %d'%len(query_label))\n",
" # Extract feature\n",
" since = time.time()\n",
" with torch.no_grad():\n",
" gallery_feature = extract_feature(model, dataloaders['bounding_box_test'], flip)\n",
" query_feature = extract_feature(model, dataloaders['query'], flip)\n",
" process_time = time.time() - since\n",
" logger.info('total forward time: %.2f minutes'%(process_time/60))\n",
" \n",
" dist = 1-torch.mm(query_feature, torch.transpose(gallery_feature, 0, 1))\n",
"\n",
" # Save to Matlab for check\n",
" extracted_feature = {'gallery_feature': gallery_feature.numpy(), 'gallery_label':gallery_label, 'gallery_cam':gallery_cam, \\\n",
" 'query_feature': query_feature.numpy(), 'query_label':query_label, 'query_cam':query_cam}\n",
"\n",
" result_name = os.path.join(save_path, name+'_feature.mat')\n",
" scipy.io.savemat(result_name, extracted_feature) \n",
"\n",
" return_dict = {}\n",
"\n",
" return_dict['dist'] = dist.numpy()\n",
" return_dict['feature_example'] = query_feature[0].numpy()\n",
" return_dict['gallery_label'] = gallery_label\n",
" return_dict['gallery_cam'] = gallery_cam\n",
" return_dict['query_label'] = query_label\n",
" return_dict['query_cam'] = query_cam\n",
"\n",
" pickle.dump(return_dict, open(OUTPUT_RESULT_DIR+'test_result.pkl', 'wb'), protocol=4)\n",
"\n",
" return \n",
"\n",
" # eval_result = evaluator(result, logger)\n",
" # full_table = display_eval_result(dict = eval_result)\n",
" # logger.info(full_table)\n",
"\n",
"if __name__==\"__main__\":\n",
" logger = get_stream_logger('TEST')\n",
" test(CONFIG_PATH, logger)"
]
},
{
"cell_type": "code",
"execution_count": null,
"id": "c27b171e",
"metadata": {},
"outputs": [],
"source": []
}
],
"metadata": {
"kernelspec": {
"display_name": "MindSpore",
"language": "python",
"name": "mindspore"
},
"language_info": {
"codemirror_mode": {
"name": "ipython",
"version": 3
},
"file_extension": ".py",
"mimetype": "text/x-python",
"name": "python",
"nbconvert_exporter": "python",
"pygments_lexer": "ipython3",
"version": "3.7.6"
}
},
"nbformat": 4,
"nbformat_minor": 5
}

+ 1
- 0
notebooks/1.md View File

@@ -0,0 +1 @@
hello

+ 35
- 0
notebooks/testwj.ipynb View File

@@ -0,0 +1,35 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": null,
"id": "14e5e20a",
"metadata": {},
"outputs": [],
"source": [
"print('hello world')"
]
}
],
"metadata": {
"kernelspec": {
"display_name": "MindSpore",
"language": "python",
"name": "mindspore"
},
"language_info": {
"codemirror_mode": {
"name": "ipython",
"version": 3
},
"file_extension": ".py",
"mimetype": "text/x-python",
"name": "python",
"nbconvert_exporter": "python",
"pygments_lexer": "ipython3",
"version": "3.7.6"
}
},
"nbformat": 4,
"nbformat_minor": 5
}

+ 1
- 0
notebooks/test测试/1.txt View File

@@ -0,0 +1 @@
well

+ 251
- 0
notebooks/test测试/wj-Untitled.ipynb View File

@@ -0,0 +1,251 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": 1,
"id": "90e7b1d4",
"metadata": {},
"outputs": [
{
"ename": "ModuleNotFoundError",
"evalue": "No module named 'torch'",
"output_type": "error",
"traceback": [
"\u001b[0;31m---------------------------------------------------------------------------\u001b[0m",
"\u001b[0;31mModuleNotFoundError\u001b[0m Traceback (most recent call last)",
"\u001b[0;32m<ipython-input-1-e39e8fd52943>\u001b[0m in \u001b[0;36m<module>\u001b[0;34m\u001b[0m\n\u001b[1;32m 8\u001b[0m \u001b[0;32mimport\u001b[0m \u001b[0myaml\u001b[0m\u001b[0;34m\u001b[0m\u001b[0;34m\u001b[0m\u001b[0m\n\u001b[1;32m 9\u001b[0m \u001b[0;32mimport\u001b[0m \u001b[0mpickle\u001b[0m\u001b[0;34m\u001b[0m\u001b[0;34m\u001b[0m\u001b[0m\n\u001b[0;32m---> 10\u001b[0;31m \u001b[0;32mimport\u001b[0m \u001b[0mtorch\u001b[0m\u001b[0;34m\u001b[0m\u001b[0;34m\u001b[0m\u001b[0m\n\u001b[0m\u001b[1;32m 11\u001b[0m \u001b[0;32mimport\u001b[0m \u001b[0mtorch\u001b[0m\u001b[0;34m.\u001b[0m\u001b[0mnn\u001b[0m \u001b[0;32mas\u001b[0m \u001b[0mnn\u001b[0m\u001b[0;34m\u001b[0m\u001b[0;34m\u001b[0m\u001b[0m\n\u001b[1;32m 12\u001b[0m \u001b[0;32mimport\u001b[0m \u001b[0mnumpy\u001b[0m \u001b[0;32mas\u001b[0m \u001b[0mnp\u001b[0m\u001b[0;34m\u001b[0m\u001b[0;34m\u001b[0m\u001b[0m\n",
"\u001b[0;31mModuleNotFoundError\u001b[0m: No module named 'torch'"
]
}
],
"source": [
"# -*- coding: utf-8 -*-\n",
"from __future__ import print_function, division\n",
"\n",
"# import sys\n",
"# sys.path.append('/home/xujiahong/openI_benchmark/vechicle_reID_VechicleNet/')\n",
"\n",
"import time\n",
"import yaml\n",
"import pickle\n",
"import torch\n",
"import torch.nn as nn\n",
"import numpy as np\n",
"from torchvision import datasets,transforms\n",
"import os\n",
"import scipy.io\n",
"from tqdm import tqdm\n",
"from data_utils.model_train import ft_net\n",
"from utils.util import get_stream_logger\n",
"from config.mainconfig import OUTPUT_RESULT_DIR, CONFIG_PATH\n",
"\n",
"\n",
"\n",
"def fliplr(img):\n",
" '''flip horizontal'''\n",
" inv_idx = torch.arange(img.size(3)-1,-1,-1).long() # N x C x H x W\n",
" img_flip = img.index_select(3,inv_idx)\n",
" return img_flip\n",
"\n",
"def extract_feature(model, dataloaders, flip):\n",
" features = torch.FloatTensor()\n",
" count = 0\n",
" for _, data in enumerate(tqdm(dataloaders),0):\n",
" img, _ = data\n",
" n, c, h, w = img.size()\n",
" count += n\n",
"\n",
" input_img = img.cuda()\n",
" ff = model(input_img)\n",
"\n",
" if flip:\n",
" img = fliplr(img)\n",
" input_img = img.cuda()\n",
" outputs_flip = model(input_img)\n",
" ff += outputs_flip\n",
"\n",
" fnorm = torch.norm(ff, p=2, dim=1, keepdim=True)\n",
" ff = ff.div(fnorm.expand_as(ff))\n",
" #print(ff.shape)\n",
" features = torch.cat((features,ff.data.cpu().float()), 0)\n",
" #features = torch.cat((features,ff.data.float()), 0)\n",
" return features\n",
"\n",
"\n",
"def get_id(img_path):\n",
" '''\n",
" xjh: \n",
" example of the name of the img: 0769_c013_00074310_0\n",
" 0769 is the vehicleID, 013 is the cameraID, 00074310 is the frameID\n",
" '''\n",
" camera_id = []\n",
" labels = []\n",
" for path, _ in img_path:\n",
" #filename = path.split('/')[-1]\n",
" filename = os.path.basename(path) #get the name of images\n",
" # Test Gallery Image\n",
" if not 'c' in filename: \n",
" labels.append(9999999)\n",
" camera_id.append(9999999)\n",
" else:\n",
" #label = filename[0:4]\n",
" label = filename[0:5] #for benchmark_person\n",
" camera = filename.split('c')[1]\n",
" if label[0:2]=='-1':\n",
" labels.append(-1)\n",
" else:\n",
" labels.append(int(label))\n",
" #camera_id.append(int(camera[0:3]))\n",
" camera_id.append(int(camera[0:2]))#for benchmark_person\n",
" #print(camera[0:3])\n",
" return camera_id, labels\n",
"\n",
"\n",
"def test(config_file_path:str, logger):\n",
" #read config files\n",
" with open(config_file_path, encoding='utf-8') as f:\n",
" opts = yaml.load(f, Loader=yaml.SafeLoader)\n",
"\n",
" data_dir = opts['input']['dataset']['data_dir']\n",
" name = \"trained_\" + opts['input']['config']['name']\n",
" trained_model_name = name + \"_last.pth\"\n",
" save_path = OUTPUT_RESULT_DIR\n",
"\n",
" nclass = opts['input']['config']['nclass']\n",
" stride = opts['input']['config']['stride']\n",
" pool = opts['input']['config']['pool']\n",
" droprate = opts['input']['config']['droprate']\n",
" inputsize= opts['input']['config']['inputsize']\n",
" w = opts['input']['config']['w']\n",
" h = opts['input']['config']['h']\n",
" batchsize = opts['input']['config']['batchsize']\n",
" flip = opts['test']['flip_test']\n",
"\n",
" trained_model_path = os.path.join(save_path, trained_model_name)\n",
"\n",
" ##############################load model#################################################\n",
" ###self-train\n",
" model = ft_net(class_num = nclass, droprate = droprate, stride=stride, init_model=None, pool = pool, return_f=False)\n",
" \n",
" try:\n",
" model.load_state_dict(torch.load(trained_model_path))\n",
" except:\n",
" model = torch.nn.DataParallel(model)\n",
" model.load_state_dict(torch.load(trained_model_path))\n",
" model = model.module\n",
" model.classifier.classifier = nn.Sequential() #model ends with feature extractor(output len is 512)\n",
" # print(model)\n",
" \n",
" ##############################load dataset###############################################\n",
" \n",
" #transforms for input image h==w==299, inputsize==256\n",
" if h == w:\n",
" data_transforms = transforms.Compose([\n",
" transforms.Resize( ( round(inputsize*1.1), round(inputsize*1.1)), interpolation=3),\n",
" transforms.ToTensor(),\n",
" transforms.Normalize([0.485, 0.456, 0.406], [0.229, 0.224, 0.225])\n",
" ])\n",
" else:\n",
" data_transforms = transforms.Compose( [\n",
" transforms.Resize((round(h*1.1), round(w*1.1)), interpolation=3), #Image.BICUBIC\n",
" transforms.ToTensor(),\n",
" transforms.Normalize([0.485, 0.456, 0.406], [0.229, 0.224, 0.225])\n",
" ])\n",
"\n",
" image_datasets = {x: datasets.ImageFolder( os.path.join(data_dir,x) ,data_transforms) for x in ['bounding_box_test','query']}\n",
" dataloaders = {x: torch.utils.data.DataLoader(image_datasets[x], batch_size=batchsize,\n",
" shuffle=False, num_workers=8) for x in ['bounding_box_test','query']}\n",
"\n",
" #############################check GPU###################################################\n",
" use_gpu = torch.cuda.is_available()\n",
"\n",
"\n",
" #############################extract features############################################\n",
" # Change to test mode\n",
" model = model.eval()\n",
" if use_gpu:\n",
" model = model.cuda()\n",
"\n",
" gallery_path = image_datasets['bounding_box_test'].imgs\n",
" query_path = image_datasets['query'].imgs\n",
"\n",
" gallery_cam,gallery_label = get_id(gallery_path)\n",
" query_cam,query_label = get_id(query_path)\n",
"\n",
"\n",
" gallery_label = np.asarray(gallery_label)\n",
" query_label = np.asarray(query_label)\n",
" gallery_cam = np.asarray(gallery_cam)\n",
" query_cam = np.asarray(query_cam)\n",
" print('Gallery Size: %d'%len(gallery_label))\n",
" print('Query Size: %d'%len(query_label))\n",
" # Extract feature\n",
" since = time.time()\n",
" with torch.no_grad():\n",
" gallery_feature = extract_feature(model, dataloaders['bounding_box_test'], flip)\n",
" query_feature = extract_feature(model, dataloaders['query'], flip)\n",
" process_time = time.time() - since\n",
" logger.info('total forward time: %.2f minutes'%(process_time/60))\n",
" \n",
" dist = 1-torch.mm(query_feature, torch.transpose(gallery_feature, 0, 1))\n",
"\n",
" # Save to Matlab for check\n",
" extracted_feature = {'gallery_feature': gallery_feature.numpy(), 'gallery_label':gallery_label, 'gallery_cam':gallery_cam, \\\n",
" 'query_feature': query_feature.numpy(), 'query_label':query_label, 'query_cam':query_cam}\n",
"\n",
" result_name = os.path.join(save_path, name+'_feature.mat')\n",
" scipy.io.savemat(result_name, extracted_feature) \n",
"\n",
" return_dict = {}\n",
"\n",
" return_dict['dist'] = dist.numpy()\n",
" return_dict['feature_example'] = query_feature[0].numpy()\n",
" return_dict['gallery_label'] = gallery_label\n",
" return_dict['gallery_cam'] = gallery_cam\n",
" return_dict['query_label'] = query_label\n",
" return_dict['query_cam'] = query_cam\n",
"\n",
" pickle.dump(return_dict, open(OUTPUT_RESULT_DIR+'test_result.pkl', 'wb'), protocol=4)\n",
"\n",
" return \n",
"\n",
" # eval_result = evaluator(result, logger)\n",
" # full_table = display_eval_result(dict = eval_result)\n",
" # logger.info(full_table)\n",
"\n",
"if __name__==\"__main__\":\n",
" logger = get_stream_logger('TEST')\n",
" test(CONFIG_PATH, logger)"
]
},
{
"cell_type": "code",
"execution_count": null,
"id": "c27b171e",
"metadata": {},
"outputs": [],
"source": []
}
],
"metadata": {
"kernelspec": {
"display_name": "MindSpore",
"language": "python",
"name": "mindspore"
},
"language_info": {
"codemirror_mode": {
"name": "ipython",
"version": 3
},
"file_extension": ".py",
"mimetype": "text/x-python",
"name": "python",
"nbconvert_exporter": "python",
"pygments_lexer": "ipython3",
"version": "3.7.6"
}
},
"nbformat": 4,
"nbformat_minor": 5
}

+ 251
- 0
notebooks/wj-Untitled.ipynb View File

@@ -0,0 +1,251 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": 1,
"id": "90e7b1d4",
"metadata": {},
"outputs": [
{
"ename": "ModuleNotFoundError",
"evalue": "No module named 'torch'",
"output_type": "error",
"traceback": [
"\u001b[0;31m---------------------------------------------------------------------------\u001b[0m",
"\u001b[0;31mModuleNotFoundError\u001b[0m Traceback (most recent call last)",
"\u001b[0;32m<ipython-input-1-e39e8fd52943>\u001b[0m in \u001b[0;36m<module>\u001b[0;34m\u001b[0m\n\u001b[1;32m 8\u001b[0m \u001b[0;32mimport\u001b[0m \u001b[0myaml\u001b[0m\u001b[0;34m\u001b[0m\u001b[0;34m\u001b[0m\u001b[0m\n\u001b[1;32m 9\u001b[0m \u001b[0;32mimport\u001b[0m \u001b[0mpickle\u001b[0m\u001b[0;34m\u001b[0m\u001b[0;34m\u001b[0m\u001b[0m\n\u001b[0;32m---> 10\u001b[0;31m \u001b[0;32mimport\u001b[0m \u001b[0mtorch\u001b[0m\u001b[0;34m\u001b[0m\u001b[0;34m\u001b[0m\u001b[0m\n\u001b[0m\u001b[1;32m 11\u001b[0m \u001b[0;32mimport\u001b[0m \u001b[0mtorch\u001b[0m\u001b[0;34m.\u001b[0m\u001b[0mnn\u001b[0m \u001b[0;32mas\u001b[0m \u001b[0mnn\u001b[0m\u001b[0;34m\u001b[0m\u001b[0;34m\u001b[0m\u001b[0m\n\u001b[1;32m 12\u001b[0m \u001b[0;32mimport\u001b[0m \u001b[0mnumpy\u001b[0m \u001b[0;32mas\u001b[0m \u001b[0mnp\u001b[0m\u001b[0;34m\u001b[0m\u001b[0;34m\u001b[0m\u001b[0m\n",
"\u001b[0;31mModuleNotFoundError\u001b[0m: No module named 'torch'"
]
}
],
"source": [
"# -*- coding: utf-8 -*-\n",
"from __future__ import print_function, division\n",
"\n",
"# import sys\n",
"# sys.path.append('/home/xujiahong/openI_benchmark/vechicle_reID_VechicleNet/')\n",
"\n",
"import time\n",
"import yaml\n",
"import pickle\n",
"import torch\n",
"import torch.nn as nn\n",
"import numpy as np\n",
"from torchvision import datasets,transforms\n",
"import os\n",
"import scipy.io\n",
"from tqdm import tqdm\n",
"from data_utils.model_train import ft_net\n",
"from utils.util import get_stream_logger\n",
"from config.mainconfig import OUTPUT_RESULT_DIR, CONFIG_PATH\n",
"\n",
"\n",
"\n",
"def fliplr(img):\n",
" '''flip horizontal'''\n",
" inv_idx = torch.arange(img.size(3)-1,-1,-1).long() # N x C x H x W\n",
" img_flip = img.index_select(3,inv_idx)\n",
" return img_flip\n",
"\n",
"def extract_feature(model, dataloaders, flip):\n",
" features = torch.FloatTensor()\n",
" count = 0\n",
" for _, data in enumerate(tqdm(dataloaders),0):\n",
" img, _ = data\n",
" n, c, h, w = img.size()\n",
" count += n\n",
"\n",
" input_img = img.cuda()\n",
" ff = model(input_img)\n",
"\n",
" if flip:\n",
" img = fliplr(img)\n",
" input_img = img.cuda()\n",
" outputs_flip = model(input_img)\n",
" ff += outputs_flip\n",
"\n",
" fnorm = torch.norm(ff, p=2, dim=1, keepdim=True)\n",
" ff = ff.div(fnorm.expand_as(ff))\n",
" #print(ff.shape)\n",
" features = torch.cat((features,ff.data.cpu().float()), 0)\n",
" #features = torch.cat((features,ff.data.float()), 0)\n",
" return features\n",
"\n",
"\n",
"def get_id(img_path):\n",
" '''\n",
" xjh: \n",
" example of the name of the img: 0769_c013_00074310_0\n",
" 0769 is the vehicleID, 013 is the cameraID, 00074310 is the frameID\n",
" '''\n",
" camera_id = []\n",
" labels = []\n",
" for path, _ in img_path:\n",
" #filename = path.split('/')[-1]\n",
" filename = os.path.basename(path) #get the name of images\n",
" # Test Gallery Image\n",
" if not 'c' in filename: \n",
" labels.append(9999999)\n",
" camera_id.append(9999999)\n",
" else:\n",
" #label = filename[0:4]\n",
" label = filename[0:5] #for benchmark_person\n",
" camera = filename.split('c')[1]\n",
" if label[0:2]=='-1':\n",
" labels.append(-1)\n",
" else:\n",
" labels.append(int(label))\n",
" #camera_id.append(int(camera[0:3]))\n",
" camera_id.append(int(camera[0:2]))#for benchmark_person\n",
" #print(camera[0:3])\n",
" return camera_id, labels\n",
"\n",
"\n",
"def test(config_file_path:str, logger):\n",
" #read config files\n",
" with open(config_file_path, encoding='utf-8') as f:\n",
" opts = yaml.load(f, Loader=yaml.SafeLoader)\n",
"\n",
" data_dir = opts['input']['dataset']['data_dir']\n",
" name = \"trained_\" + opts['input']['config']['name']\n",
" trained_model_name = name + \"_last.pth\"\n",
" save_path = OUTPUT_RESULT_DIR\n",
"\n",
" nclass = opts['input']['config']['nclass']\n",
" stride = opts['input']['config']['stride']\n",
" pool = opts['input']['config']['pool']\n",
" droprate = opts['input']['config']['droprate']\n",
" inputsize= opts['input']['config']['inputsize']\n",
" w = opts['input']['config']['w']\n",
" h = opts['input']['config']['h']\n",
" batchsize = opts['input']['config']['batchsize']\n",
" flip = opts['test']['flip_test']\n",
"\n",
" trained_model_path = os.path.join(save_path, trained_model_name)\n",
"\n",
" ##############################load model#################################################\n",
" ###self-train\n",
" model = ft_net(class_num = nclass, droprate = droprate, stride=stride, init_model=None, pool = pool, return_f=False)\n",
" \n",
" try:\n",
" model.load_state_dict(torch.load(trained_model_path))\n",
" except:\n",
" model = torch.nn.DataParallel(model)\n",
" model.load_state_dict(torch.load(trained_model_path))\n",
" model = model.module\n",
" model.classifier.classifier = nn.Sequential() #model ends with feature extractor(output len is 512)\n",
" # print(model)\n",
" \n",
" ##############################load dataset###############################################\n",
" \n",
" #transforms for input image h==w==299, inputsize==256\n",
" if h == w:\n",
" data_transforms = transforms.Compose([\n",
" transforms.Resize( ( round(inputsize*1.1), round(inputsize*1.1)), interpolation=3),\n",
" transforms.ToTensor(),\n",
" transforms.Normalize([0.485, 0.456, 0.406], [0.229, 0.224, 0.225])\n",
" ])\n",
" else:\n",
" data_transforms = transforms.Compose( [\n",
" transforms.Resize((round(h*1.1), round(w*1.1)), interpolation=3), #Image.BICUBIC\n",
" transforms.ToTensor(),\n",
" transforms.Normalize([0.485, 0.456, 0.406], [0.229, 0.224, 0.225])\n",
" ])\n",
"\n",
" image_datasets = {x: datasets.ImageFolder( os.path.join(data_dir,x) ,data_transforms) for x in ['bounding_box_test','query']}\n",
" dataloaders = {x: torch.utils.data.DataLoader(image_datasets[x], batch_size=batchsize,\n",
" shuffle=False, num_workers=8) for x in ['bounding_box_test','query']}\n",
"\n",
" #############################check GPU###################################################\n",
" use_gpu = torch.cuda.is_available()\n",
"\n",
"\n",
" #############################extract features############################################\n",
" # Change to test mode\n",
" model = model.eval()\n",
" if use_gpu:\n",
" model = model.cuda()\n",
"\n",
" gallery_path = image_datasets['bounding_box_test'].imgs\n",
" query_path = image_datasets['query'].imgs\n",
"\n",
" gallery_cam,gallery_label = get_id(gallery_path)\n",
" query_cam,query_label = get_id(query_path)\n",
"\n",
"\n",
" gallery_label = np.asarray(gallery_label)\n",
" query_label = np.asarray(query_label)\n",
" gallery_cam = np.asarray(gallery_cam)\n",
" query_cam = np.asarray(query_cam)\n",
" print('Gallery Size: %d'%len(gallery_label))\n",
" print('Query Size: %d'%len(query_label))\n",
" # Extract feature\n",
" since = time.time()\n",
" with torch.no_grad():\n",
" gallery_feature = extract_feature(model, dataloaders['bounding_box_test'], flip)\n",
" query_feature = extract_feature(model, dataloaders['query'], flip)\n",
" process_time = time.time() - since\n",
" logger.info('total forward time: %.2f minutes'%(process_time/60))\n",
" \n",
" dist = 1-torch.mm(query_feature, torch.transpose(gallery_feature, 0, 1))\n",
"\n",
" # Save to Matlab for check\n",
" extracted_feature = {'gallery_feature': gallery_feature.numpy(), 'gallery_label':gallery_label, 'gallery_cam':gallery_cam, \\\n",
" 'query_feature': query_feature.numpy(), 'query_label':query_label, 'query_cam':query_cam}\n",
"\n",
" result_name = os.path.join(save_path, name+'_feature.mat')\n",
" scipy.io.savemat(result_name, extracted_feature) \n",
"\n",
" return_dict = {}\n",
"\n",
" return_dict['dist'] = dist.numpy()\n",
" return_dict['feature_example'] = query_feature[0].numpy()\n",
" return_dict['gallery_label'] = gallery_label\n",
" return_dict['gallery_cam'] = gallery_cam\n",
" return_dict['query_label'] = query_label\n",
" return_dict['query_cam'] = query_cam\n",
"\n",
" pickle.dump(return_dict, open(OUTPUT_RESULT_DIR+'test_result.pkl', 'wb'), protocol=4)\n",
"\n",
" return \n",
"\n",
" # eval_result = evaluator(result, logger)\n",
" # full_table = display_eval_result(dict = eval_result)\n",
" # logger.info(full_table)\n",
"\n",
"if __name__==\"__main__\":\n",
" logger = get_stream_logger('TEST')\n",
" test(CONFIG_PATH, logger)"
]
},
{
"cell_type": "code",
"execution_count": null,
"id": "c27b171e",
"metadata": {},
"outputs": [],
"source": []
}
],
"metadata": {
"kernelspec": {
"display_name": "MindSpore",
"language": "python",
"name": "mindspore"
},
"language_info": {
"codemirror_mode": {
"name": "ipython",
"version": 3
},
"file_extension": ".py",
"mimetype": "text/x-python",
"name": "python",
"nbconvert_exporter": "python",
"pygments_lexer": "ipython3",
"version": "3.7.6"
}
},
"nbformat": 4,
"nbformat_minor": 5
}

Loading…
Cancel
Save